Skip to product information
1 of 1

PTH, Human (HEK293, His)

PTH, Human (HEK293, His)

Size

SKU:QM-0198891-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (HEK293, His) is the recombinant human-derived PTH protein, expressed by HEK293 , with N-8*His labeled tag.

  • Molecular Formula

    5741 (Gene_ID) P01270 (S32-Q115) (Accession)

  • Smiles

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

  • Purity

    95.75

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0198891-01
5 µgQM-0198891-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0198891-02
10 µgQM-0198891-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0198891-03
50 µgQM-0198891-03
£293.00/ea
£0.00
£293.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PTH, Human (HEK293, His)

PTH, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.