Skip to product information
1 of 1

PTP4A2, Human (His)

PTP4A2, Human (His)

Size

SKU:QM-0203372-01

£61.22 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (His) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    8073 (Gene_ID) Q12974 (M1-Q167) (Accession)

  • Smiles

    MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203372-01
5 µgQM-0203372-01
£61.22/ea
£0.00
£61.22/ea £0.00
10 µgQM-0203372-02
10 µgQM-0203372-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0203372-03
50 µgQM-0203372-03
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0203372-04
100 µgQM-0203372-04
£388.99/ea
£0.00
£388.99/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

PTP4A2, Human (His)

PTP4A2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.