PTPRG, Human

Name: PTPRG, Human
Brand: QuantiMol
SKU: QM-0191684-01
Price: 362.95 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0191684-01

£362.95 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
PTPRG protein, also known as G-type protein tyrosine phosphatase receptor, is characterized by its tyrosine phosphatase activity. As a member of the protein tyrosine phosphatase (PTP) family, PTPRG is involved in the dephosphorylation of tyrosine residues in target proteins. PTPRG Protein, Human is the recombinant human-derived PTPRG protein, expressed by E. coli , with tag free.
Molecular Formula
5793 (Gene_ID) P23470 (P820-N1130) (Accession)
Smiles
PIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSN
Purity
97
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0191684-01	10 µgQM-0191684-01 £362.95/ea	£0.00	Quantity	£362.95/ea	£0.00

50 µgQM-0191684-02	50 µgQM-0191684-02 £827.09/ea	£0.00	Quantity	£827.09/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

PTPRG, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.