Skip to product information
1 of 1

PVALB, Human (His)

PVALB, Human (His)

Size

SKU:QM-0096136

Price on request
Quantity

Request quote or documents

View full details
  • Description

    PVALB Protein, also known as parvalbumin, plays a key role in muscle tissue by facilitating relaxation after contraction. Its function involves binding two calcium ions, indicating a crucial role in regulating calcium dynamics within muscle cells. Parvalbumin's ability to sequester calcium underscores its significance in fine-tuning the balance between contraction and relaxation, contributing to overall muscle physiology control. PVALB Protein, Human (His) is the recombinant human-derived PVALB protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    5816 (Gene_ID) P20472 (S2-S110) (Accession)

  • Smiles

    SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0096136
1 EachQM-0096136
£0.00/ea
£0.00
£0.00/ea £0.00

PVALB, Human (His)

PVALB, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.