PVALB, Human (His)
PVALB, Human (His)
SKU:QM-0096136
Request quote or documents

Product Details
-
Description
PVALB Protein, also known as parvalbumin, plays a key role in muscle tissue by facilitating relaxation after contraction. Its function involves binding two calcium ions, indicating a crucial role in regulating calcium dynamics within muscle cells. Parvalbumin's ability to sequester calcium underscores its significance in fine-tuning the balance between contraction and relaxation, contributing to overall muscle physiology control. PVALB Protein, Human (His) is the recombinant human-derived PVALB protein, expressed by E. coli , with C-6*His labeled tag.
-
Molecular Formula
5816 (Gene_ID) P20472 (S2-S110) (Accession)
-
Smiles
SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
PVALB, Human (His)
PVALB, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.