Skip to product information
1 of 1

RAC2, Human (His)

RAC2, Human (His)

Size

SKU:QM-0200534-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    5880 (Gene_ID) P15153 (M1-C189) (Accession)

  • Smiles

    MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200534-01
5 µgQM-0200534-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0200534-02
10 µgQM-0200534-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0200534-03
50 µgQM-0200534-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RAC2, Human (His)

RAC2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.