RANKL/TNFSF11, Mouse (CHO, His)

Name: RANKL/TNFSF11, Mouse (CHO, His)
Brand: QuantiMol
SKU: QM-0203501-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203501-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.
Molecular Formula
21943 (Gene_ID) O35235-1 (R72-D316) (Accession)
Smiles
RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203501-01	2 µgQM-0203501-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203501-02	10 µgQM-0203501-02 £125.13/ea	£0.00	Quantity	£125.13/ea	£0.00

50 µgQM-0203501-03	50 µgQM-0203501-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0203501-04	100 µgQM-0203501-04 £476.46/ea	£0.00	Quantity	£476.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

RANKL/TNFSF11, Mouse (CHO, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.