Skip to product information
1 of 1

RANKL/TNFSF11, Mouse (HEK293, Fc)

RANKL/TNFSF11, Mouse (HEK293, Fc)

Size

SKU:QM-0205728-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs) . RANKL/TNFSF11 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANKL (R72-D316) with N-terminal hFc tag, which is produced in HEK293[1][2].

  • Molecular Formula

    21943 (Gene_ID) AAC40113.1/ O35235-1 (R72-D316) (Accession)

  • Smiles

    RAQMDPNRISEDSTHCFYRILRLHENAGLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205728-01
2 µgQM-0205728-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0205728-02
10 µgQM-0205728-02
£107.13/ea
£0.00
£107.13/ea £0.00
20 µgQM-0205728-03
20 µgQM-0205728-03
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0205728-04
50 µgQM-0205728-04
£316.08/ea
£0.00
£316.08/ea £0.00
100 µgQM-0205728-05
100 µgQM-0205728-05
£475.25/ea
£0.00
£475.25/ea £0.00
500 µgQM-0205728-06
500 µgQM-0205728-06
£1,239.48/ea
£0.00
£1,239.48/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RANKL/TNFSF11, Mouse (HEK293, Fc)

RANKL/TNFSF11, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.