Skip to product information
1 of 1

RBP1, Human

RBP1, Human

Size

SKU:QM-0077290-01

£210.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    5947 (Gene_ID) P09455 (P2-Q135) (Accession)

  • Smiles

    PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0077290-01
10 µgQM-0077290-01
£210.38/ea
£0.00
£210.38/ea £0.00
50 µgQM-0077290-02
50 µgQM-0077290-02
£504.41/ea
£0.00
£504.41/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RBP1, Human

RBP1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.