RBP4, Canine (HEK293, His)

Name: RBP4, Canine (HEK293, His)
Brand: QuantiMol
SKU: QM-0077093-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0077093-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
RBP4 Protein is a member of the lipocalin family and the major transport protein of the hydrophobic molecule retinol, also known as vitamin A, in the circulation. RBP4 Protein, Canine (HEK293, His) is the recombinant canine-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
477775 (Gene_ID) XP_038295882 (E19-L201) (Accession)
Smiles
ESDCRVSNFQVKKNFDKARFAGTWYAMAKKDPEGLFLQDNIVAEFSVDENGRMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPLEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSEPNTL
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0077093-01	5 µgQM-0077093-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0077093-02	10 µgQM-0077093-02 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0077093-03	50 µgQM-0077093-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0077093-04	100 µgQM-0077093-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

RBP4, Canine (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.