RBP4, Cynomolgus (HEK293, His)

Name: RBP4, Cynomolgus (HEK293, His)
Brand: QuantiMol
SKU: QM-0202698-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202698-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
RBP4 Protein, a vital retinol transporter in blood plasma, mediates the transfer from liver stores to peripheral tissues. It also enhances retinol transport by interacting with TTR. RBP4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
102136826 (Gene_ID) A0A2K5W172 (E19-L201) (Accession)
Smiles
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIIDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQRIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202698-01	5 µgQM-0202698-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0202698-02	10 µgQM-0202698-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0202698-03	50 µgQM-0202698-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0202698-04	100 µgQM-0202698-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

RBP4, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.