Skip to product information
1 of 1

RBP4, Human

RBP4, Human

Size

SKU:QM-0185245-01

£117.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human is the recombinant human-derived RBP4 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    5950 (Gene_ID) P02753 (E19-L201) (Accession)

  • Smiles

    ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0185245-01
10 µgQM-0185245-01
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0185245-02
50 µgQM-0185245-02
£327.02/ea
£0.00
£327.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RBP4, Human

RBP4, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.