Skip to product information
1 of 1

RBP4, Human (HEK293, C-His)

RBP4, Human (HEK293, C-His)

Size

SKU:QM-0202583-01

£102.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RBP4 protein acts as a retinol-binding protein, essential for transporting retinol in blood plasma. It facilitates the delivery of retinol from the liver to peripheral tissues and likely transfers bound all-trans retinol to STRA6 for cell membrane transport. Interactions with TTR prevent kidney glomeruli filtration loss. Direct interaction with STRA6 underscores RBP4's role in intricate retinol transport and distribution processes in the body. RBP4 Protein, Human (HEK293, C-His) is the recombinant human-derived RBP4 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    5950 (Gene_ID) P02753 (E19-L201) (Accession)

  • Smiles

    ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202583-01
5 µgQM-0202583-01
£102.63/ea
£0.00
£102.63/ea £0.00
10 µgQM-0202583-02
10 µgQM-0202583-02
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0202583-03
50 µgQM-0202583-03
£454.60/ea
£0.00
£454.60/ea £0.00
100 µgQM-0202583-04
100 µgQM-0202583-04
£736.48/ea
£0.00
£736.48/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RBP4, Human (HEK293, C-His)

RBP4, Human (HEK293, C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.