RBP5, Human

Size 1 Each

SKU:QM-0166915

Price on request

Quote Datasheet SDS COA

Product Details

Description
RBP5 actively transports retinol intracellularly. RBP5 Protein, Human is the recombinant human-derived RBP5 protein, expressed by E. coli , with tag free.
Molecular Formula
83758 (Gene_ID) P82980 (M1-R135) (Accession)
Smiles
MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
1 EachQM-0166915	1 EachQM-0166915 £0.00/ea	£0.00	Quantity	£0.00/ea	£0.00

RBP5, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.