RCN3, Rat (HEK293, His)

Name: RCN3, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0202733-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202733-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The RCN3 protein is a possible molecular chaperone critical for protein biosynthesis and transport within the endoplasmic reticulum. Its involvement extends to the biosynthesis and transport of key proteins, including SP-A, SP-D, and ABCA3, highlighting the importance of pulmonary surfactant homeostasis. RCN3 Protein, Rat (HEK293, His) is the recombinant rat-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
494125 (Gene_ID) I6L9G5 (K21-H324) (Accession)
Smiles
KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDQLTPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRH
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202733-01	5 µgQM-0202733-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202733-02	10 µgQM-0202733-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0202733-03	50 µgQM-0202733-03 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

100 µgQM-0202733-04	100 µgQM-0202733-04 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

RCN3, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.