Skip to product information
1 of 1

RecO, E.coli (His-SUMO)

RecO, E.coli (His-SUMO)

Size

SKU:QM-0204566-01

£238.32 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RecO protein, a crucial participant in DNA repair and the RecF pathway, operates as a monomer, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination. Its monomeric form underscores its singular involvement, highlighting its significance in orchestrating cellular responses to DNA damage and recombination. RecO Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecO protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    947038 (Gene_ID) P0A7H3 (M1-E242) (Accession)

  • Smiles

    MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204566-01
5 µgQM-0204566-01
£238.32/ea
£0.00
£238.32/ea £0.00
10 µgQM-0204566-02
10 µgQM-0204566-02
£370.76/ea
£0.00
£370.76/ea £0.00
20 µgQM-0204566-03
20 µgQM-0204566-03
£597.97/ea
£0.00
£597.97/ea £0.00
50 µgQM-0204566-04
50 µgQM-0204566-04
£879.85/ea
£0.00
£879.85/ea £0.00
100 µgQM-0204566-05
100 µgQM-0204566-05
£1,295.38/ea
£0.00
£1,295.38/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RecO, E.coli (His-SUMO)

RecO, E.coli (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.