REG-3 beta/REG3B, Mouse (HEK293, His)

REG-3 beta/REG3B Protein, a bactericidal C-type lectin, combats intestinal Gram-positive and Gram-negative bacteria, except S.typhimurium.It inhibits S.enteritidis translocation, safeguarding against infection.Beyond antibacterial action, REG-3 beta functions hormonally, activating EXTL3 receptor for cell-specific signaling.In the pancreas, it notably stimulates cell proliferation.REG-3 beta/REG3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 beta/REG3B protein, expressed by HEK293 , with C-His labeled tag.

18489 (Gene_ID) P35230 (E27-G175) (Accession)

MLPPTACSVMSWMLLSCLMLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG

95

Stored at -20°C for 2 years

Room temperature in continental US; may vary elsewhere.