REG-4, Human (HEK293, His)

Name: REG-4, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0186675-01
Price: 117.25 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0186675-01

£117.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
83998 (Gene_ID) Q9BYZ8-1 (D23-P158) (Accession)
Smiles
DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0186675-01	10 µgQM-0186675-01 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0186675-02	50 µgQM-0186675-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

REG-4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.