Renin, Mouse (HEK293, His)

Name: Renin, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0075475-01
Price: 188.51 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0075475-01

£188.51 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Renin Protein, a highly specific endopeptidase, generates angiotensin I from angiotensinogen, initiating a cascade that elevates blood pressure and enhances kidney sodium retention.Renin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.
Molecular Formula
19701 (Gene_ID) P06281 (L22-R402) (Accession)
Smiles
LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0075475-01	10 µgQM-0075475-01 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0075475-02	50 µgQM-0075475-02 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Renin, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.