Skip to product information
1 of 1

Resistin, Mouse (HEK293, Fc)

Resistin, Mouse (HEK293, Fc)

Size

SKU:QM-0203546-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Resistin hormone inhibits insulin's efficacy in promoting glucose uptake into adipose cells, potentially linking obesity and diabetes. Structurally, it forms stabilizing disulfide linkages as a homodimer. The interplay between resistin and insulin reveals complex molecular mechanisms in metabolic regulation, providing insights into how resistin may contribute to the pathophysiological connections between obesity and diabetes. Resistin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Resistin protein, expressed by HEK293 , with N-hFc labeled tag.

  • Molecular Formula

    57264 (Gene_ID) Q99P87 (S21-S114) (Accession)

  • Smiles

    SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203546-01
2 µgQM-0203546-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0203546-02
10 µgQM-0203546-02
£88.00/ea
£0.00
£88.00/ea £0.00
50 µgQM-0203546-03
50 µgQM-0203546-03
£243.19/ea
£0.00
£243.19/ea £0.00
100 µgQM-0203546-04
100 µgQM-0203546-04
£376.83/ea
£0.00
£376.83/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Resistin, Mouse (HEK293, Fc)

Resistin, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.