Skip to product information
1 of 1

RGS5, Human (His)

RGS5, Human (His)

Size

SKU:QM-0202685-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RGS5, an adept signal transduction modulator, enhances G protein alpha subunit GTPase activity, promoting their transition to the inactive GDP-bound state. Interacting with G (i) -alpha and G (o) -alpha, it selectively excludes G (s) -alpha, highlighting its precise role in regulating specific G protein subunits and fine-tuning cellular signaling pathways. RGS5 Protein, Human (His) is the recombinant human-derived RGS5 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    8490 (Gene_ID) O15539 (M1-K181) (Accession)

  • Smiles

    MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202685-01
5 µgQM-0202685-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0202685-02
10 µgQM-0202685-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0202685-03
50 µgQM-0202685-03
£313.65/ea
£0.00
£313.65/ea £0.00
100 µgQM-0202685-04
100 µgQM-0202685-04
£498.33/ea
£0.00
£498.33/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RGS5, Human (His)

RGS5, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.