Skip to product information
1 of 1

RIZ1, Human (His)

RIZ1, Human (His)

Size

SKU:QM-0203867-01

£76.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RIZ1 Protein, an S-adenosyl-L-methionine-dependent histone methyltransferase, specifically methylates 'Lys-9' of histone H3. Additionally, it acts as a DNA-binding transcription factor, showing affinity for the MTE within the HMOX1 gene. Implicated as a potential activator, RIZ1 suggests a regulatory role in HMOX1 gene expression beyond histone modification. RIZ1 Protein, Human (His) is the recombinant human-derived RIZ1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    7799 (Gene_ID) Q13029 (M1-A200) (Accession)

  • Smiles

    MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203867-01
5 µgQM-0203867-01
£76.75/ea
£0.00
£76.75/ea £0.00
10 µgQM-0203867-02
10 µgQM-0203867-02
£122.88/ea
£0.00
£122.88/ea £0.00
50 µgQM-0203867-03
50 µgQM-0203867-03
£342.81/ea
£0.00
£342.81/ea £0.00
100 µgQM-0203867-04
100 µgQM-0203867-04
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RIZ1, Human (His)

RIZ1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.