Rnase 3, Human (HEK293, His)

Name: Rnase 3, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0184157-01
Price: 252.39 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0184157-01

£252.39 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Rnase 3 Protein, Human (HEK293, His) is the recombinant human-derived Rnase 3 protein, expressed by HEK293, with C-6*His labeled tag.
Molecular Formula
6037 (Gene_ID) AAH96060.1 (R28-I160) (Accession)
Smiles
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0184157-01	10 µgQM-0184157-01 £252.39/ea	£0.00	Quantity	£252.39/ea	£0.00

50 µgQM-0184157-02	50 µgQM-0184157-02 £573.15/ea	£0.00	Quantity	£573.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Rnase 3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.