Skip to product information
1 of 1

ROM1, Human (His)

ROM1, Human (His)

Size

SKU:QM-0205488-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ROM1 protein is involved in rod outer segment (ROS) morphogenesis, and may work with PRPH2 to maintain the structure of the curved intervertebral disc and organize ROS, thus affecting the intervertebral disc diameter. In addition, ROM1 is involved in protecting the retinal outer nuclear layer. ROM1 Protein, Human (His) is the recombinant human-derived ROM1 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    6094 (Gene_ID) Q03395 (P126-D263) (Accession)

  • Smiles

    PGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQD

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205488-01
5 µgQM-0205488-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0205488-02
10 µgQM-0205488-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0205488-03
50 µgQM-0205488-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0205488-04
100 µgQM-0205488-04
£426.65/ea
£0.00
£426.65/ea £0.00
500 µgQM-0205488-05
500 µgQM-0205488-05
£1,156.87/ea
£0.00
£1,156.87/ea £0.00
1 mgQM-0205488-06
1 mgQM-0205488-06
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ROM1, Human (His)

ROM1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.