Skip to product information
1 of 1

ROR1, Human (HEK293, His)

ROR1, Human (HEK293, His)

Size

SKU:QM-0172625-01

£90.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (HEK293, His) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    4919 (Gene_ID) Q01973-1 (Q30-E403) (Accession)

  • Smiles

    QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0172625-01
10 µgQM-0172625-01
£90.25/ea
£0.00
£90.25/ea £0.00
50 µgQM-0172625-02
50 µgQM-0172625-02
£249.26/ea
£0.00
£249.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ROR1, Human (HEK293, His)

ROR1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.