Skip to product information
1 of 1

RORC, Mouse (P. pastoris, His)

RORC, Mouse (P. pastoris, His)

Size

SKU:QM-0026112

Price on request
Quantity

Request quote or documents

View full details
  • Description

    RORC Protein, Mouse (P. pastoris, His) is the recombinant human-derived RORC, expressed by P. pastoris , with N-6*His labeled tag.

  • Molecular Formula

    6097 (Gene_ID) P51449-1 (M1-K518) (Accession)

  • Smiles

    MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0026112
1 EachQM-0026112
£0.00/ea
£0.00
£0.00/ea £0.00

RORC, Mouse (P. pastoris, His)

RORC, Mouse (P. pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.