RPE, Human (His)

Name: RPE, Human (His)
Brand: QuantiMol
SKU: QM-0186890-01
Price: 158.0 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0186890-01

£158.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The RPE Protein is responsible for catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. RPE Protein, Human (His) is the recombinant human-derived RPE protein, expressed by E. coli , with C-6*His labeled tag.
Molecular Formula
6120 (Gene_ID) Q96AT9-1 (M1-R228) (Accession)
Smiles
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0186890-01	10 µgQM-0186890-01 £158.00/ea	£0.00	Quantity	£158.00/ea	£0.00

50 µgQM-0186890-02	50 µgQM-0186890-02 £406.69/ea	£0.00	Quantity	£406.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

RPE, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.