RSPO1/R-spondin-1, Mouse (189a.a, His)

Name: RSPO1/R-spondin-1, Mouse (189a.a, His)
Brand: QuantiMol
SKU: QM-0197456-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0197456-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
RSPO1 activates the canonical Wnt signaling pathway by binding to the LGR4-6 receptor, triggering an increase in target gene expression. It inhibits ZNRF3, regulates the Wnt signaling pathway, and negatively regulates the TGF-β pathway. RSPO1/R-spondin-1 Protein, Mouse (189a.a, His) is the recombinant mouse-derived RSPO1/R-spondin-1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
192199 (Gene_ID) Q9Z132 (S21-G209) (Accession)
Smiles
SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEALYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRKGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEG
Purity
96.5
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0197456-01	2 µgQM-0197456-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0197456-02	10 µgQM-0197456-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0197456-03	50 µgQM-0197456-03 £310.01/ea	£0.00	Quantity	£310.01/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

RSPO1/R-spondin-1, Mouse (189a.a, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.