Skip to product information
1 of 1

RTBDN, Human (HEK293, His)

RTBDN, Human (HEK293, His)

Size

SKU:QM-0131603

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The RTBDN Protein, binding riboflavin, potentially transports retinal flavins, playing a crucial role in essential vitamin transport. Its specific riboflavin binding suggests importance in supporting retinal health through flavin molecule regulation, impacting various biological processes. RTBDN Protein, Human (HEK293, His) is the recombinant human-derived RTBDN protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    83546 (Gene_ID) Q9BSG5 (S31-P229) (Accession)

  • Smiles

    SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0131603
1 EachQM-0131603
£0.00/ea
£0.00
£0.00/ea £0.00

RTBDN, Human (HEK293, His)

RTBDN, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.