RTBDN, Human (HEK293, His)
RTBDN, Human (HEK293, His)
SKU:QM-0131603
Request quote or documents

Product Details
-
Description
The RTBDN Protein, binding riboflavin, potentially transports retinal flavins, playing a crucial role in essential vitamin transport. Its specific riboflavin binding suggests importance in supporting retinal health through flavin molecule regulation, impacting various biological processes. RTBDN Protein, Human (HEK293, His) is the recombinant human-derived RTBDN protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
83546 (Gene_ID) Q9BSG5 (S31-P229) (Accession)
-
Smiles
SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
RTBDN, Human (HEK293, His)
RTBDN, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.