Skip to product information
1 of 1

RuvB, E.coli (His-SUMO)

RuvB, E.coli (His-SUMO)

Size

SKU:QM-0195301-01

£205.52 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RuvB protein is an important component of the RuvABC complex and plays a key role in recombinant DNA repair, especially for UV-induced damage. It helps rescue stalled DNA replication forks through replication fork reversal (RFR) . RuvB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvB protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    946371 (Gene_ID) P0A812 (M1-P336) (Accession)

  • Smiles

    MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0195301-01
5 µgQM-0195301-01
£205.52/ea
£0.00
£205.52/ea £0.00
10 µgQM-0195301-02
10 µgQM-0195301-02
£316.08/ea
£0.00
£316.08/ea £0.00
50 µgQM-0195301-03
50 µgQM-0195301-03
£780.22/ea
£0.00
£780.22/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RuvB, E.coli (His-SUMO)

RuvB, E.coli (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.