Skip to product information
1 of 1

RUVBL2, Human (His-SUMO)

RUVBL2, Human (His-SUMO)

Size

SKU:QM-0205089-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The RUVBL2 protein has DNA-stimulated ATPase and DNA helicase activities and can hexamerize for ATP hydrolysis. As a member of the NuA4 complex, RUVBL2 contributes to histone acetylation, altering nucleosome-DNA interactions to activate genes. RUVBL2 Protein, Human (His-SUMO) is the recombinant human-derived RUVBL2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    10856 (Gene_ID) Q9Y230-1 (A2-S463) (Accession)

  • Smiles

    ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205089-01
5 µgQM-0205089-01
£147.63/ea
£0.00
£147.63/ea £0.00
10 µgQM-0205089-02
10 µgQM-0205089-02
£277.21/ea
£0.00
£277.21/ea £0.00
20 µgQM-0205089-03
20 µgQM-0205089-03
£437.58/ea
£0.00
£437.58/ea £0.00
50 µgQM-0205089-04
50 µgQM-0205089-04
£747.41/ea
£0.00
£747.41/ea £0.00
100 µgQM-0205089-05
100 µgQM-0205089-05
£1,134.99/ea
£0.00
£1,134.99/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RUVBL2, Human (His-SUMO)

RUVBL2, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.