Skip to product information
1 of 1

RuvC, E.coli (His-SUMO)

RuvC, E.coli (His-SUMO)

Size

SKU:QM-0195906-01

£249.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    RuvC protein is an important component of the RuvA-RuvB-RuvC complex and is essential for the processing of Holliday junctions in gene recombination and DNA repair. As an endonuclease, RuvC resolves Holliday junctions by generating symmetric single-stranded nicks that rely on a central homology core. RuvC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    946378 (Gene_ID) P0A814 (A2-R173) (Accession)

  • Smiles

    AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0195906-01
5 µgQM-0195906-01
£249.26/ea
£0.00
£249.26/ea £0.00
10 µgQM-0195906-02
10 µgQM-0195906-02
£387.77/ea
£0.00
£387.77/ea £0.00
50 µgQM-0195906-03
50 µgQM-0195906-03
£990.41/ea
£0.00
£990.41/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

RuvC, E.coli (His-SUMO)

RuvC, E.coli (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.