Skip to product information
1 of 1

S100A1, Human (C-His)

S100A1, Human (C-His)

Size

SKU:QM-0204845-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca (2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca (2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human (C-His) is the recombinant human-derived S100A1 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    6271 (Gene_ID) P23297 (M1-S94) (Accession)

  • Smiles

    MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204845-01
5 µgQM-0204845-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0204845-02
10 µgQM-0204845-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0204845-03
50 µgQM-0204845-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0204845-04
100 µgQM-0204845-04
£426.65/ea
£0.00
£426.65/ea £0.00
500 µgQM-0204845-05
500 µgQM-0204845-05
£1,100.97/ea
£0.00
£1,100.97/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A1, Human (C-His)

S100A1, Human (C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.