Skip to product information
1 of 1

S100A10, Human (His)

S100A10, Human (His)

Size

SKU:QM-0077105-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    S100A10 Protein is pivotal in modulating protein phosphorylation by promoting ANXA2/p36 dimerization. The ANXA2 monomer is the favored substrate for tyrosine-specific kinase activity in vitro. A heterotetramer, composed of S100A10/p11 and ANXA2/p36, highlights intricate regulatory dynamics. This interaction landscape includes SCN10A and TASOR, showcasing S100A10's multifaceted involvement in cellular processes. S100A10 Protein, Human (His) is the recombinant human-derived S100A10 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    6281 (Gene_ID) P60903 (P2-K97) (Accession)

  • Smiles

    PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0077105-01
5 µgQM-0077105-01
£127.38/ea
£0.00
£127.38/ea £0.00
10 µgQM-0077105-02
10 µgQM-0077105-02
£238.32/ea
£0.00
£238.32/ea £0.00
50 µgQM-0077105-03
50 µgQM-0077105-03
£587.03/ea
£0.00
£587.03/ea £0.00
100 µgQM-0077105-04
100 µgQM-0077105-04
£974.62/ea
£0.00
£974.62/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A10, Human (His)

S100A10, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.