S100A11, Human

Name: S100A11, Human
Brand: QuantiMol
SKU: QM-0176360-01
Price: 232.25 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0176360-01

£232.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
S100A11 Protein facilitates keratinocyte differentiation and cornification, forming homodimers via disulfide linkages. S100A11 Protein, Human is the recombinant human-derived S100A11 protein, expressed by E. coli , with tag free.
Molecular Formula
6282 (Gene_ID) P31949 (M1-T105) (Accession)
Smiles
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0176360-01	10 µgQM-0176360-01 £232.25/ea	£0.00	Quantity	£232.25/ea	£0.00

50 µgQM-0176360-02	50 µgQM-0176360-02 £561.51/ea	£0.00	Quantity	£561.51/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

S100A11, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.