S100A12, Human

Name: S100A12, Human
Brand: QuantiMol
SKU: QM-0181971-01
Price: 133.0 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0181971-01

£133.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The S100A12 protein is a calcium, zinc, and copper binder that regulates inflammation and immune responses. As a DAMP molecule, it activates innate immune cells through AGER, triggering pro-inflammatory pathways. S100A12 Protein, Human is the recombinant human-derived S100A12 protein, expressed by E. coli , with tag free.
Molecular Formula
6283 (Gene_ID) P80511 (M1-E92) (Accession)
Smiles
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0181971-01	10 µgQM-0181971-01 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

50 µgQM-0181971-02	50 µgQM-0181971-02 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

S100A12, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.