Skip to product information
1 of 1

S100A14 Protein, Human (His)

S100A14 Protein, Human (His)

Size

SKU:QM-0203646-01

£95.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The S100A14 protein, encoded by a gene on chromosome 1, is a member of the S100 protein family with calcium-binding ability. It shows decreased levels in cancerous tissue, suggesting a potential tumor suppressor role and association with metastasis. S100A14 exhibits biased expression in the esophagus (RPKM 798.1), skin (RPKM 171.2), and other tissues, indicating its potential significance in these contexts. S100A14 Protein, Human (His, solution) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    57402 (Gene_ID) NP_065723.1 (G2-H104) (Accession)

  • Smiles

    GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203646-01
5 µgQM-0203646-01
£95.54/ea
£0.00
£95.54/ea £0.00
10 µgQM-0203646-02
10 µgQM-0203646-02
£119.75/ea
£0.00
£119.75/ea £0.00
50 µgQM-0203646-03
50 µgQM-0203646-03
£260.89/ea
£0.00
£260.89/ea £0.00
100 µgQM-0203646-04
100 µgQM-0203646-04
£335.01/ea
£0.00
£335.01/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A14 Protein, Human (His)

S100A14 Protein, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.