S100A2, Human

Name: S100A2, Human
Brand: QuantiMol
SKU: QM-0205299-01
Price: 76.75 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0205299-01

£76.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The S100A2 protein is a potential calcium sensor that actively promotes cellular calcium signaling and affects various physiological processes. As a homodimer, it interacts with TPR-containing proteins, including FKBP4, and participates in multiple molecular associations. S100A2 Protein, Human is the recombinant human-derived S100A2 protein, expressed by E. coli , with tag free.
Molecular Formula
6273 (Gene_ID) P29034 (M1-P98) (Accession)
Smiles
MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205299-01	5 µgQM-0205299-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0205299-02	10 µgQM-0205299-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0205299-03	50 µgQM-0205299-03 £337.95/ea	£0.00	Quantity	£337.95/ea	£0.00

100 µgQM-0205299-04	100 µgQM-0205299-04 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

500 µgQM-0205299-05	500 µgQM-0205299-05 £1,444.82/ea	£0.00	Quantity	£1,444.82/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

S100A2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.