Skip to product information
1 of 1

S100A6, Human (His)

S100A6, Human (His)

Size

SKU:QM-0201169-01

£97.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The S100A6 protein is a key calcium sensor that actively promotes cellular calcium signaling and is involved in multiple processes, including actin cytoskeletal reorganization and cell motility. As a homodimer binding two calcium ions, it interacts with TPR-containing proteins, CACYBP, ANXA2, ANXA11, SUGT1, tropomyosin, TP53, PPP5C, and TPPP. S100A6 Protein, Human (His) is the recombinant human-derived S100A6 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    6277 (Gene_ID) P06703 (M1-G90) (Accession)

  • Smiles

    MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

  • Purity

    99.9

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0201169-01
10 µgQM-0201169-01
£97.61/ea
£0.00
£97.61/ea £0.00
50 µgQM-0201169-02
50 µgQM-0201169-02
£230.52/ea
£0.00
£230.52/ea £0.00
100 µgQM-0201169-03
100 µgQM-0201169-03
£338.65/ea
£0.00
£338.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A6, Human (His)

S100A6, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.