Skip to product information
1 of 1

S100A8, Human (C-His)

S100A8, Human (C-His)

Size

SKU:QM-0170290-01

£132.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8 Protein, Human (C-His) is the recombinant human-derived S100A8 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    6279 (Gene_ID) P05109 (M1-E93) (Accession)

  • Smiles

    MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0170290-01
10 µgQM-0170290-01
£132.13/ea
£0.00
£132.13/ea £0.00
50 µgQM-0170290-02
50 µgQM-0170290-02
£318.00/ea
£0.00
£318.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A8, Human (C-His)

S100A8, Human (C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.