Skip to product information
1 of 1

S100A8, Rat (His)

S100A8, Rat (His)

Size

SKU:QM-0181462-01

£147.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    S100A8 protein functions as a danger signal in inflammation, activating innate immune cells by binding to receptors like Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) . This triggers signaling pathways that enhance the pro-inflammatory response. S100A8 Protein, Rat (His) is the recombinant rat-derived S100A8 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    116547 (Gene_ID) P50115 (M1-E89) (Accession)

  • Smiles

    MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0181462-01
10 µgQM-0181462-01
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0181462-02
50 µgQM-0181462-02
£448.52/ea
£0.00
£448.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A8, Rat (His)

S100A8, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.