Skip to product information
1 of 1

S100A9, Human (His)

S100A9, Human (His)

Size

SKU:QM-0205957-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Human (His) is the recombinant human-derived S100A9 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    6280 (Gene_ID) P06702 (T2-P114) (Accession)

  • Smiles

    TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205957-01
2 µgQM-0205957-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0205957-02
5 µgQM-0205957-02
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0205957-03
10 µgQM-0205957-03
£72.61/ea
£0.00
£72.61/ea £0.00
50 µgQM-0205957-04
50 µgQM-0205957-04
£133.00/ea
£0.00
£133.00/ea £0.00
100 µgQM-0205957-05
100 µgQM-0205957-05
£266.27/ea
£0.00
£266.27/ea £0.00
250 µgQM-0205957-06
250 µgQM-0205957-06
£409.64/ea
£0.00
£409.64/ea £0.00
500 µgQM-0205957-07
500 µgQM-0205957-07
£625.91/ea
£0.00
£625.91/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A9, Human (His)

S100A9, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.