Skip to product information
1 of 1

S100A9, Mouse (His)

S100A9, Mouse (His)

Size

SKU:QM-0205673-01

£69.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes.S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2.S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response.S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E.coli , with N-6*His labeled tag.

  • Molecular Formula

    20202 (Gene_ID) P31725 (A2-K113) (Accession)

  • Smiles

    ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205673-01
5 µgQM-0205673-01
£69.50/ea
£0.00
£69.50/ea £0.00
10 µgQM-0205673-02
10 µgQM-0205673-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0205673-03
50 µgQM-0205673-03
£293.00/ea
£0.00
£293.00/ea £0.00
100 µgQM-0205673-04
100 µgQM-0205673-04
£470.39/ea
£0.00
£470.39/ea £0.00
500 µgQM-0205673-05
500 µgQM-0205673-05
£1,223.69/ea
£0.00
£1,223.69/ea £0.00
1 mgQM-0205673-06
1 mgQM-0205673-06
£2,042.60/ea
£0.00
£2,042.60/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100A9, Mouse (His)

S100A9, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.