S100B, Human (His)

Name: S100B, Human (His)
Brand: QuantiMol
SKU: QM-0203026-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203026-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The S100B protein binds calcium and zinc ions, each with a different site on the monomer. Physiological levels of potassium ions disrupt the binding of calcium and zinc, affecting high-affinity sites. S100B Protein, Human (His) is the recombinant human-derived S100B protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
6285 (Gene_ID) P04271 (M1-E92) (Accession)
Smiles
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203026-01	5 µgQM-0203026-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0203026-02	10 µgQM-0203026-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0203026-03	50 µgQM-0203026-03 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

100 µgQM-0203026-04	100 µgQM-0203026-04 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

S100B, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.