Skip to product information
1 of 1

S100B, Mouse (His)

S100B, Mouse (His)

Size

SKU:QM-0173172-01

£137.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities.Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both.S100B Protein, Mouse (His) is the recombinant mouse-derived S100B protein, expressed by E.coli , with C-6*His labeled tag.

  • Molecular Formula

    20203 (Gene_ID) P50114 (M1-E92) (Accession)

  • Smiles

    MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0173172-01
10 µgQM-0173172-01
£137.50/ea
£0.00
£137.50/ea £0.00
50 µgQM-0173172-02
50 µgQM-0173172-02
£415.71/ea
£0.00
£415.71/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

S100B, Mouse (His)

S100B, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.