S100P, Human (His)

Name: S100P, Human (His)
Brand: QuantiMol
SKU: QM-0204441-01
Price: 101.5 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0204441-01

£101.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The S100P protein is a multifunctional calcium sensor that actively contributes to cellular calcium signaling. It interacts calcium-dependently with proteins such as EZR and PPP5C, indirectly affecting processes such as microvilli formation. S100P Protein, Human (His) is the recombinant human-derived S100P protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
6286 (Gene_ID) P25815 (T2-K95) (Accession)
Smiles
TELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204441-01	5 µgQM-0204441-01 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

10 µgQM-0204441-02	10 µgQM-0204441-02 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

50 µgQM-0204441-03	50 µgQM-0204441-03 £421.79/ea	£0.00	Quantity	£421.79/ea	£0.00

100 µgQM-0204441-04	100 µgQM-0204441-04 £636.85/ea	£0.00	Quantity	£636.85/ea	£0.00

500 µgQM-0204441-05	500 µgQM-0204441-05 £1,488.56/ea	£0.00	Quantity	£1,488.56/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

S100P, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.