Skip to product information
1 of 1

SAA1, Human (His)

SAA1, Human (His)

Size

SKU:QM-0169386-01

£133.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    6288 (Gene_ID) AAH07022.1 (R19-Y122) (Accession)

  • Smiles

    RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY

  • Purity

    97.21

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169386-01
5 µgQM-0169386-01
£133.00/ea
£0.00
£133.00/ea £0.00
10 µgQM-0169386-02
10 µgQM-0169386-02
£238.32/ea
£0.00
£238.32/ea £0.00
50 µgQM-0169386-03
50 µgQM-0169386-03
£614.98/ea
£0.00
£614.98/ea £0.00
100 µgQM-0169386-04
100 µgQM-0169386-04
£935.74/ea
£0.00
£935.74/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SAA1, Human (His)

SAA1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.