Skip to product information
1 of 1

SAE1, Human (GST)

SAE1, Human (GST)

Size

SKU:QM-0096077

Price on request
Quantity

Request quote or documents

View full details
  • Description

    SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    10055 (Gene_ID) Q9UBE0 (M1-K346) (Accession)

  • Smiles

    MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0096077
1 EachQM-0096077
£0.00/ea
£0.00
£0.00/ea £0.00

SAE1, Human (GST)

SAE1, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.