SAE1, Human (GST)
SAE1, Human (GST)
SKU:QM-0096077
Request quote or documents

Product Details
-
Description
SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag.
-
Molecular Formula
10055 (Gene_ID) Q9UBE0 (M1-K346) (Accession)
-
Smiles
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
SAE1, Human (GST)
SAE1, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.