Skip to product information
1 of 1

Sap130, Mouse (His)

Sap130, Mouse (His)

Size

SKU:QM-0202458-01

£112.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Sap130 Protein, a transcriptional repressor, participates in mSin3A corepressor complex assembly or enzymatic activity. It's a component of the complex, including SIN3A, SAP130, SUDS3/SAP45, ARID4B/SAP180, HDAC1, and HDAC2. Sap130 also interacts with CLEC4E, especially when released by dead or dying cells. Sap130 Protein, Mouse (His) is the recombinant mouse-derived Sap130 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    269003 (Gene_ID) Q8BIH0-1 (P845-V1057) (Accession)

  • Smiles

    PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202458-01
5 µgQM-0202458-01
£112.75/ea
£0.00
£112.75/ea £0.00
10 µgQM-0202458-02
10 µgQM-0202458-02
£203.09/ea
£0.00
£203.09/ea £0.00
20 µgQM-0202458-03
20 µgQM-0202458-03
£293.00/ea
£0.00
£293.00/ea £0.00
50 µgQM-0202458-04
50 µgQM-0202458-04
£515.35/ea
£0.00
£515.35/ea £0.00
100 µgQM-0202458-05
100 µgQM-0202458-05
£793.58/ea
£0.00
£793.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Sap130, Mouse (His)

Sap130, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.