SBDS, Mouse (His)

Name: SBDS, Mouse (His)
Brand: QuantiMol
SKU: QM-0203103-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203103-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.
Molecular Formula
66711 (Gene_ID) P70122 (M1-E250) (Accession)
Smiles
MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203103-01	5 µgQM-0203103-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0203103-02	10 µgQM-0203103-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0203103-03	50 µgQM-0203103-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0203103-04	100 µgQM-0203103-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SBDS, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.