Skip to product information
1 of 1

SBDS, Mouse (His)

SBDS, Mouse (His)

Size

SKU:QM-0203103-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    66711 (Gene_ID) P70122 (M1-E250) (Accession)

  • Smiles

    MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203103-01
5 µgQM-0203103-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0203103-02
10 µgQM-0203103-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0203103-03
50 µgQM-0203103-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203103-04
100 µgQM-0203103-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SBDS, Mouse (His)

SBDS, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.