SCF, Human (sf9, His)
SCF, Human (sf9, His)
SKU:QM-0127718
Request quote or documents

Product Details
-
Description
SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (sf9, His) is the recombinant human-derived SCF protein, expressed by Sf9 insect cells , with C-His labeled tag.
-
Molecular Formula
4254 (Gene_ID) P21583-1 (E26-A189) (Accession)
-
Smiles
EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
SCF, Human (sf9, His)
SCF, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.