Skip to product information
1 of 1

SCF, Human (sf9, His)

SCF, Human (sf9, His)

Size

SKU:QM-0127718

Price on request
Quantity

Request quote or documents

View full details
  • Description

    SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. SCF Protein, Human (sf9, His) is the recombinant human-derived SCF protein, expressed by Sf9 insect cells , with C-His labeled tag.

  • Molecular Formula

    4254 (Gene_ID) P21583-1 (E26-A189) (Accession)

  • Smiles

    EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0127718
1 EachQM-0127718
£0.00/ea
£0.00
£0.00/ea £0.00

SCF, Human (sf9, His)

SCF, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.